CLIC5 Protein, Human (His)

The CLIC5 protein is essential for normal hearing and contributes to the formation of stereocilia and the development of the organ of Corti in the inner ear. It forms poorly selective ion channels that may transport chloride ions. CLIC5 Protein, Human (His) is the recombinant human-derived CLIC5 protein, expressed by E. coli , with N-6*His labeled tag.

CLIC5 protein is essential for normal hearing, as it is necessary for the formation of stereocilia in the inner ear and the proper development of the organ of Corti. It has the ability to insert into membranes and form ion channels that are poorly selective, possibly transporting chloride ions. Moreover, CLIC5 may play a role in regulating the absorption and secretion of ions across epithelial cells. It is also crucial for the development and maintenance of the appropriate architecture of glomerular endothelial cells and podocytes in the kidney. Additionally, CLIC5 contributes to the formation of the lens suture in the eye, which is vital for maintaining the lens's optical properties. It is a component of a complex comprising various cytoskeletal proteins, including actin, ezrin, alpha-actinin, gelsolin, and IQGAP1, and interacts with AKAP9.

Human

E. coli

N-6*His

Q9NZA1-2 (M1-S251)

53405  [NCBI]

MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Approximately 37.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 0.01% Tween80, 0.01% TritonX-100, pH8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.