1. Recombinant Proteins
  2. Others
  3. Clusterin/APOJ Protein, Human (HEK293, His)

Clusterin/APOJ Protein, Human (HEK293, His)

Cat. No.: HY-P7895
SDS COA Handling Instructions

Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the C-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the C-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD)[1].

Background

Clusterin is a ubiquitously and constitutively expressed protein found in a wide range of tissues and bodily fluids. Clusterin’s ability to interact and bind to Aβ appears to alter aggregation and promote Aβ clearance, suggesting a neuroprotective role[1].

Biological Activity

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

  • Measured by its ability to induce clustering of Caki‑2 human clear cell carcinoma epithelial cells.
Species

Human

Source

HEK293

Tag

C-His

Accession

P10909 (D23-E449)

Gene ID
Molecular Construction
N-term
Clusterin (D23-E449)
Accession # P10909
His
C-term
Synonyms
rHuClusterin/APOJ, His ; Clusterin; Aging-Associated Gene 4 Protein; Apolipoprotein J; Apo-J; Complement Cytolysis Inhibitor; CLI; Complement-Associated Protein SP-40; Ku70-Binding Protein 1; NA1/NA2; Testosterone-Repressed Prostate Message 2; TRPM-2; CLU; APOJ; CLI; KUB1
AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Molecular Weight

Approximately (28-40)& 60.96 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Clusterin/APOJ Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Clusterin/APOJ Protein, Human (HEK293, His)
Cat. No.:
HY-P7895
Quantity:
MCE Japan Authorized Agent: