1. Recombinant Proteins
  2. Others
  3. Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His)

Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His)

Cat. No.: HY-P70063
COA Handling Instructions

Clusterin-like protein 1/CLUL1 Protein belongs to the clusterin family.Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is the recombinant human-derived Clusterin-like protein 1/CLUL1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $95 In-stock
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Clusterin-like protein 1/CLUL1 Protein belongs to the clusterin family.Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is the recombinant human-derived Clusterin-like protein 1/CLUL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Claudin-18/CLDN18.2 Protein-VLP, Macaca fascicularis, is a member of the claudin family. It is associated with macaques and is likely utilized for vaccine-related applications. Clusterin-like protein 1/CLUL1 Protein is a member of the clusterin family, involved in various cellular processes, potentially implicated in neuroprotection and cell survival mechanisms.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q15846 (A21-A442)

Gene ID

27098  [NCBI]

Molecular Construction
N-term
CLUL1 (A21-A442)
Accession # Q15846
6*His
C-term
Synonyms
rHuClusterin-like protein 1/CLUL1, His; Clusterin-Like Protein 1; Retinal-Specific Clusterin-Like Protein; CLUL1
AA Sequence

APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESA

Molecular Weight

The protein migrates as 59-80 kDa under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70063
Quantity:
MCE Japan Authorized Agent: