1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. IREM-1/CD300f
  5. CMRF35-like molecule 1 Protein, Rat (Myc, His-SUMO)

CMRF35-like molecule 1 Protein, Rat (Myc, His-SUMO)

Cat. No.: HY-P71561
Handling Instructions Technical Support

CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CMRF35-like molecule 1 Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CMRF35-like molecule 1 Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor for myeloid cells and mast cells, playing a crucial role in immune homeostasis by modulating various immune responses. CLM-1 positively regulates the phagocytosis of apoptotic cells, known as efferocytosis, through the recognition and binding of phosphatidylserine (PS) on the surface of apoptotic cells. This activity promotes macrophage-mediated efferocytosis while inhibiting dendritic cell-mediated efferocytosis. Furthermore, CLM-1 negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses by binding to ceramide and sphingomyelin as ligands. It may also function as a coreceptor for interleukin 4 (IL-4), interacting with and regulating IL-4 receptor alpha-mediated responses, thereby augmenting IL-4- and IL-13-induced signaling. In addition, CLM-1 negatively regulates Toll-like receptor (TLR) signaling by activating phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. Beyond its immunomodulatory functions, CLM-1 inhibits osteoclast formation and induces macrophage cell death upon engagement. The protein interacts with PTPN6/SHP-1 in a tyrosine phosphorylation-dependent manner and associates with IL4R.

Species

Rat

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

Q566E6 (A19-S181)

Gene ID
Molecular Construction
N-term
10*His-SUMO
CMRF35-like molecule 1 (A19-S181)
Accession # Q566E6
Myc
C-term
Synonyms
Cd300lf; Clm1CMRF35-like molecule 1; CLM-1; CD300 antigen-like family member F; CD antigen CD300f
AA Sequence

AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS

Molecular Weight

Approximately 38.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CMRF35-like molecule 1 Protein, Rat (Myc, His-SUMO)
Cat. No.:
HY-P71561
Quantity:
MCE Japan Authorized Agent: