1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. CNTF
  5. CNTF Protein, Human (HEK293)

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family. CNTF could protect retinal cone and rod photoreceptors. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. CNTF Protein, Human (HEK293) is produced by HEK293 cells (M1-M200) with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 35 In-stock
10 μg USD 68 In-stock
50 μg USD 190 In-stock
100 μg USD 320 In-stock
> 100 μg   Get quote  

Get it by May 1 for select sizes. Order within 20 hrs 50 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CNTF Protein, Human (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human (HEK293) is produced by HEK293 cells (M1-M200) with tag free.

Background

Ciliary Neurotrophic Factor (CNTF) belongs to the IL-6 cytokine family. IL-6, IL-11 and CNTF are associated with cytokine trans signaling. CNTF shows a low affinity interaction with IL-6 receptor subunit alpha (IL-6Rα), leading to the formation and activation of the IL-6Rβ/gp130/LIFR signaling receptor complex[1]. CNTF is also an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes[3]. The similarity of human CNTF protein sequences to mice and rats was 81.82% and 84.0%, respectively.

In Vitro

CNTF (human; 20 ng/mL; 3 d) significantly inhibits the activity of choline acetyltransferase (ChAT) in mesencephalic cultures[4].

Biological Activity

Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 0.0890-0.3240 μg/mL, corresponding to a specific activity of > 3086.4 units/mg.

  • Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 0.0890-0.3240 μg/mL, corresponding to a specific activity of > 3086.4 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P26441 (M1-M200)

Gene ID
Molecular Construction
N-term
CNTF (M1-M200)
Accession # P26441
C-term
Synonyms
rHuCNTF; Ciliary Neurotrophic Factor
AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Molecular Weight

22-28 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CNTF Protein, Human (HEK293) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNTF Protein, Human (HEK293)
Cat. No.:
HY-P7145
Quantity:
MCE Japan Authorized Agent: