Coagulation Factor XI/F11 Protein, Human (His)

Coagulation factor XI (F11) occupies a central position in the middle phase of the intrinsic pathway of blood coagulation, where it assumes the key role of activating factor IX. This complex process plays a key role in the chain of events that lead to the formation of a blood clot. Coagulation Factor XI/F11 Protein, Human (His) is the recombinant human-derived Coagulation Factor XI/F11 protein, expressed by E. coli , with N-6*His labeled tag.

Coagulation Factor XI, also known as F11, plays a pivotal role in the middle phase of the intrinsic pathway of blood coagulation. Its key function lies in activating Factor IX, contributing to the cascade of events that lead to the formation of a stable blood clot. Factor XI's role in the intrinsic pathway underscores its importance in the regulation of hemostasis, as it bridges the connection between upstream and downstream coagulation factors.

Human

E. coli

N-6*His

P03951-1 (E19-R387)

2160  [NCBI]

ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR

Approximately 45.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.