Coagulation Factor XII/F12 Protein, Pig (His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (His) is the recombinant pig-derived Coagulation Factor XII/F12 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Coagulation Factor XII/F12 Protein, Pig (His) is 352 a.a., with molecular weight of ~43.8 kDa.

Coagulation Factor XII, also known as F12, is a serum glycoprotein with multifaceted roles in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Factor XII participates in the intricate cascade of events by cleaving prekallikrein to form kallikrein. Subsequently, factor XII undergoes cleavage itself, initially to alpha-factor XIIa and then to beta-factor XIIa through trypsin activity. Notably, alpha-factor XIIa is implicated in the activation of Factor XI to Factor XIa, contributing to the propagation of the coagulation cascade.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Pig

E. coli

N-6*His

O97507 (I20-R371)

397474  [NCBI]

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Approximately 43.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.