1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Coagulation Factor XII/F12 Protein, Pig (His)

Coagulation Factor XII/F12 Protein, Pig (His)

Cat. No.: HY-P72189
Data Sheet Handling Instructions Technical Support

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (His) is the recombinant pig-derived Coagulation Factor XII/F12 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Coagulation Factor XII/F12 Protein, Pig (His) is 352 a.a., with molecular weight of ~43.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (His) is the recombinant pig-derived Coagulation Factor XII/F12 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Coagulation Factor XII/F12 Protein, Pig (His) is 352 a.a., with molecular weight of ~43.8 kDa.

Background

Coagulation Factor XII, also known as F12, is a serum glycoprotein with multifaceted roles in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Factor XII participates in the intricate cascade of events by cleaving prekallikrein to form kallikrein. Subsequently, factor XII undergoes cleavage itself, initially to alpha-factor XIIa and then to beta-factor XIIa through trypsin activity. Notably, alpha-factor XIIa is implicated in the activation of Factor XI to Factor XIa, contributing to the propagation of the coagulation cascade.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Pig

Source

E. coli

Tag

N-6*His

Accession

O97507 (I20-R371)

Gene ID
Molecular Construction
N-term
6*His
F12 (I20-R371)
Accession # O97507
C-term
Synonyms
F12 Coagulation factor XII; EC 3.4.21.38; Hageman factor; HAF; Coagulation factor XIIa heavy chain; Coagulation factor XIIa light chain
AA Sequence

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Weight

Approximately 43.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Coagulation Factor XII/F12 Protein, Pig (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Coagulation Factor XII/F12 Protein, Pig (His)
Cat. No.:
HY-P72189
Quantity:
MCE Japan Authorized Agent: