1. Recombinant Proteins
  2. Others
  3. COL4A1 Protein, Human (GST)

COL4A1 protein is an important type IV collagen component that forms the main structural framework of the glomerular basement membrane (GBM) with a unique "chicken wire" mesh structure. It cooperates with laminin, proteoglycans and nestin/nesidin to maintain the structural integrity of GBM. COL4A1 Protein, Human (GST) is the recombinant human-derived COL4A1 protein, expressed by E. coli , with N-GST labeled tag. The total length of COL4A1 Protein, Human (GST) is 138 a.a., with molecular weight of ~ 42 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

COL4A1 protein is an important type IV collagen component that forms the main structural framework of the glomerular basement membrane (GBM) with a unique "chicken wire" mesh structure. It cooperates with laminin, proteoglycans and nestin/nesidin to maintain the structural integrity of GBM. COL4A1 Protein, Human (GST) is the recombinant human-derived COL4A1 protein, expressed by E. coli , with N-GST labeled tag. The total length of COL4A1 Protein, Human (GST) is 138 a.a., with molecular weight of ~ 42 kDa.

Background

COL4A1 protein, a pivotal component of Type IV collagen, constitutes the primary structural framework of glomerular basement membranes (GBM), forming a distinctive 'chicken-wire' meshwork in collaboration with laminins, proteoglycans, and entactin/nidogen. Additionally, Arresten, consisting of the C-terminal NC1 domain of COL4A1, exerts a potent inhibitory effect on angiogenesis and tumor formation. Notably, the anti-angiogenic activity resides in the C-terminal half of COL4A1, where it selectively hampers endothelial cell proliferation, migration, and tube formation. This dual role of COL4A1 highlights its significance not only in maintaining the structural integrity of GBMs but also in modulating crucial processes such as angiogenesis and tumor development through the activity of Arresten.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P02462 (30G-167P)

Gene ID
Molecular Construction
N-term
GST
COL4A1 (30G-167P)
Accession # P02462
C-term
Synonyms
Arresten; BSVD; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1(IV) chain
AA Sequence

GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP

Molecular Weight

Approximately 42 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

COL4A1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COL4A1 Protein, Human (GST)
Cat. No.:
HY-P71444
Quantity:
MCE Japan Authorized Agent: