1. Recombinant Proteins
  2. Others
  3. COL4A3 Protein, Human (His)

The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM). Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3(IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of COL4A3 Protein, Human (His) is 242 a.a., with molecular weight of ~30.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM). Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3(IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of COL4A3 Protein, Human (His) is 242 a.a., with molecular weight of ~30.6 kDa.

Background

COL4A3 protein, a crucial component of type IV collagen, serves as the major structural element in glomerular basement membranes (GBM), participating in the formation of a 'chicken-wire' meshwork alongside laminins, proteoglycans, and entactin/nidogen. Notably, tumstatin, a cleavage fragment derived from the collagen alpha 3(IV) NC1 domain, exhibits dual anti-angiogenic and anti-tumor cell activities. The regulation of these anti-tumor properties appears to involve RGD-independent mechanisms mediated by ITGB3, highlighting the intricate role of COL4A3 in influencing angiogenesis and tumor cell behavior.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q01955 (G1427-K1668)

Gene ID
Molecular Construction
N-term
6*His
COL4A3 (G1427-K1668)
Accession # Q01955
C-term
Synonyms
Alpha 3 type IV collagen; Alpha3 type IV collagen; CO4A3_HUMAN; COL4A 3; Col4a3; Collagen alpha 3IV; chain; Collagen IV alpha 3 polypeptide; Collagen type IV alpha 3 Goodpasture antigen; ; Collagen type IV alpha 3; Collagen type IV alpha 3 chain; Goodpasture antigen; OTTHUMP00000195044; Tumstatin
AA Sequence

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

Molecular Weight

Approximately 30.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

COL4A3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COL4A3 Protein, Human (His)
Cat. No.:
HY-P72148
Quantity:
MCE Japan Authorized Agent: