Collagen alpha-1(III) chain/COL3A Protein, Mouse (HEK293, His)

COL3A protein, also known as collagen α-1(III) chain, is an important component of type III collagen and is widely distributed along with type I collagen in most soft connective tissues. In addition to its structural role, COL3A is also involved in the regulation of cortical development. Collagen alpha-1 (III) chain/COL3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1(III) chain/COL3A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (III) chain/COL3A Protein, Mouse (HEK293, His) is 1065 a.a., with molecular weight of ~130.0 kDa.

Collagen alpha-1(III) chain, encoded by the COL3A gene, is a vital constituent of collagen type III, prominently found in various soft connective tissues alongside type I collagen. This protein assumes a crucial role in the intricate regulation of cortical development. Particularly noteworthy is its role as the principal ligand for ADGRG1 in the developing brain. The binding of Collagen alpha-1(III) chain to ADGRG1 has profound effects, including the inhibition of neuronal migration and activation of the RhoA pathway. This activation is achieved by facilitating the coupling of ADGRG1 to GNA13 and possibly GNA12. The trimeric structure of Collagen alpha-1(III) chain consists of identical alpha 1(III) chains, connected through interchain disulfide bonds, and further stabilized by cross-linking through hydroxylysines. This intricate interplay highlights the multifaceted involvement of Collagen alpha-1(III) chain in developmental processes, particularly within the context of neuronal regulation. (

Mouse

HEK293

C-6*His

P08121 (Q155-G1219)

12825  [NCBI]

QFDSYDVKSGVGGMGGYPGPAGPPGPPGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGSPGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGPKGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGSPGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGEGGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGPAGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGKDGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGPPGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGARGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGPVGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGAAAIAGVGGEKSGGFSPYYG

Approximately 130.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM HAc-NaAc, 150 mM NaCl, pH 4.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Guidong Yao, et al. Lnc-GULP1-2:1 affects granulosa cell proliferation by regulating COL3A1 expression and localization. J Ovarian Res. 2021 Jan 20;14(1):16.  [Content Brief]

  [2]. Yihong Wang, et al. Collagen type III α1 as a useful diagnostic immunohistochemical marker for fibroepithelial lesions of the breast. Hum Pathol. 2016 Nov;57:176-181.  [Content Brief]