Collagen alpha-1(VIII) chain/COL8A1 Protein, Human (HEK293, His)

Collagen alpha-1(VIII) chain (COL8A1) is an important macromolecular component of Descemet membrane formation and the endothelial lining of blood vessels. COL8A1 is critical for vascular smooth muscle cell migration and proliferation, suggesting its importance in maintaining the structural integrity of the vessel wall, particularly in atherogenesis. Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is the recombinant human-derived Collagen alpha-1(VIII) chain/COL8A1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is 717 a.a., with molecular weight of ~54.55 & 78.13 kDa, respectively.

Collagen alpha-1(VIII) chain (COL8A1) emerges as a crucial macromolecular constituent within the subendothelium, playing a major role in the formation of Descemet's membrane, a basement membrane found in corneal endothelial cells. Additionally, it constitutes a significant component of the endothelial lining of blood vessels. COL8A1's involvement is deemed essential for the migration and proliferation of vascular smooth muscle cells, thereby suggesting its potential significance in maintaining the structural integrity of vessel walls, particularly in processes like atherogenesis. Notably, the C-terminal fragment known as Vastatin, which encompasses the NC1 domain, demonstrates inhibitory effects on aortic endothelial cell proliferation and induces apoptosis, adding an intriguing layer to the functional repertoire of COL8A1.

Human

HEK293

C-6*His

P27658 (G28-M744)

1295  [NCBI]

GAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

Approximately 54.55&78.13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.