1. Recombinant Proteins
  2. Others
  3. Collagen alpha-1(VIII) chain/COL8A1 Protein, Human (HEK293, His)

Collagen alpha-1(VIII) chain/COL8A1 Protein, Human (HEK293, His)

Cat. No.: HY-P70018
SDS COA Handling Instructions Technical Support

Collagen alpha-1(VIII) chain (COL8A1) is an important macromolecular component of Descemet membrane formation and the endothelial lining of blood vessels. COL8A1 is critical for vascular smooth muscle cell migration and proliferation, suggesting its importance in maintaining the structural integrity of the vessel wall, particularly in atherogenesis. Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is the recombinant human-derived Collagen alpha-1(VIII) chain/COL8A1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is 717 a.a., with molecular weight of ~54.55 & 78.13 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Collagen alpha-1(VIII) chain (COL8A1) is an important macromolecular component of Descemet membrane formation and the endothelial lining of blood vessels. COL8A1 is critical for vascular smooth muscle cell migration and proliferation, suggesting its importance in maintaining the structural integrity of the vessel wall, particularly in atherogenesis. Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is the recombinant human-derived Collagen alpha-1(VIII) chain/COL8A1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is 717 a.a., with molecular weight of ~54.55 & 78.13 kDa, respectively.

Background

Collagen alpha-1(VIII) chain (COL8A1) emerges as a crucial macromolecular constituent within the subendothelium, playing a major role in the formation of Descemet's membrane, a basement membrane found in corneal endothelial cells. Additionally, it constitutes a significant component of the endothelial lining of blood vessels. COL8A1's involvement is deemed essential for the migration and proliferation of vascular smooth muscle cells, thereby suggesting its potential significance in maintaining the structural integrity of vessel walls, particularly in processes like atherogenesis. Notably, the C-terminal fragment known as Vastatin, which encompasses the NC1 domain, demonstrates inhibitory effects on aortic endothelial cell proliferation and induces apoptosis, adding an intriguing layer to the functional repertoire of COL8A1.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P27658 (G28-M744)

Gene ID
Molecular Construction
N-term
COL8A1 (G28-M744)
Accession # P27658
6*His
C-term
Synonyms
rHuCollagen alpha-1(VIII) chain/COL8A1, His ; Collagen Alpha-1(VIII) Chain; Endothelial Collagen; Vastatin; COL8A1; C3orf7
AA Sequence

GAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

Molecular Weight

Approximately 54.55&78.13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Collagen alpha-1(VIII) chain/COL8A1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Collagen alpha-1(VIII) chain/COL8A1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70018
Quantity:
MCE Japan Authorized Agent: