1. Recombinant Proteins
  2. Others
  3. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO)

Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO)

Cat. No.: HY-P71629
Handling Instructions Technical Support

The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

The Collectrin protein assumes a crucial role in amino acid transport by serving as a binding partner for amino acid transporters SLC6A18 and SLC6A19, thereby regulating their trafficking on the cell surface and modulating their activity. It may also play a part in the trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Furthermore, Collectrin acts as a regulator of SNARE complex function and functions as a stimulator of beta cell replication. It exists both as a monomer and a homodimer, with the dimerization preventing CLTRN cleavage by BACE2. In its functional role, Collectrin interacts with SNAPIN and amino acid transporters SLC6A18, SLC6A19, and SLC6A20B, intricately regulating their membrane trafficking and amino acid transporter activities. These molecular interactions highlight Collectrin's versatile involvement in amino acid transport and cellular processes, emphasizing its significance in maintaining proper cellular function.

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

Q9ESG4 (E15-P141)

Gene ID
Molecular Construction
N-term
10*His-SUMO
Collectrin (E15-P141)
Accession # Q9ESG4
C-term
Synonyms
Cltrn; Nx17; Tmem27Collectrin; Transmembrane protein 27
AA Sequence

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Molecular Weight

Approximately 34.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO)
Cat. No.:
HY-P71629
Quantity:
MCE Japan Authorized Agent: