COMMD9 Protein, Human (His)

COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.

The COMMD9 protein is implicated in modulating the activity of cullin-RING E3 ubiquitin ligase (CRL) complexes, suggesting its role in the regulation of ubiquitin-dependent protein degradation pathways. Additionally, it may down-regulate the activation of NF-kappa-B, indicating its involvement in modulating immune and inflammatory responses. In epithelial cells, COMMD9 plays a role in the modulation of Na(+) transport by regulating the apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits. The protein interacts with RELB and NFKB1/p105, underscoring its potential involvement in NF-kappa-B signaling pathways. Furthermore, COMMD9 engages with CCDC22, CCDC93, SCNN1B, and CUL1, pointing towards its diverse interactions with various proteins involved in cellular processes such as protein degradation, ion transport, and immune response. These findings highlight the versatile and regulatory functions of COMMD9 within cellular pathways.

Human

E. coli

N-6*His

Q9P000-1 (M1-K198)

29099  [NCBI]

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Approximately 24 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.