1. Recombinant Proteins
  2. Others
  3. COMMD9 Protein, Human (His)

COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The COMMD9 protein is implicated in modulating the activity of cullin-RING E3 ubiquitin ligase (CRL) complexes, suggesting its role in the regulation of ubiquitin-dependent protein degradation pathways. Additionally, it may down-regulate the activation of NF-kappa-B, indicating its involvement in modulating immune and inflammatory responses. In epithelial cells, COMMD9 plays a role in the modulation of Na(+) transport by regulating the apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits. The protein interacts with RELB and NFKB1/p105, underscoring its potential involvement in NF-kappa-B signaling pathways. Furthermore, COMMD9 engages with CCDC22, CCDC93, SCNN1B, and CUL1, pointing towards its diverse interactions with various proteins involved in cellular processes such as protein degradation, ion transport, and immune response. These findings highlight the versatile and regulatory functions of COMMD9 within cellular pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9P000-1 (M1-K198)

Gene ID

29099  [NCBI]

Molecular Construction
N-term
6*His
COMMD9 (M1-K198)
Accession # Q9P000-1
C-term
Synonyms
COMM domain-containing protein 9; HSPC166
AA Sequence

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Molecular Weight

Approximately 24 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

COMMD9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COMMD9 Protein, Human (His)
Cat. No.:
HY-P76846
Quantity:
MCE Japan Authorized Agent: