1. Recombinant Proteins
  2. Complement System
  3. Complement Component 3
  4. Complement Component 3a
  5. Complement C5/C5a Protein, Cynomolgus

Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5/C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free. The total length of Complement C5/C5a Protein, Cynomolgus is 74 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5/C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free. The total length of Complement C5/C5a Protein, Cynomolgus is 74 a.a., with molecular weight of ~11 kDa.

Background

Upon activation by a C5 convertase, Complement C5 initiates the spontaneous assembly of the late complement components, C5-C9, forming the membrane attack complex. The transient binding site for C6 on C5b is crucial for the foundation of the lytic complex. The proteolytic degradation of complement C5 produces C5a anaphylatoxin, a mediator of local inflammatory processes. C5a interacts with its receptor C5AR1, triggering diverse responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Acting as a potent chemokine, C5a stimulates the locomotion of polymorphonuclear leukocytes and guides their migration toward sites of inflammation, contributing to the orchestration of immune responses.

Biological Activity

1.Immobilized Cynomolgus Complement C5a at 2 μg/mL (100 μL/well) can bind Anti-C5a (Human IgG1) with a linear range of 0.8-13 ng/mL.
2.Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a. The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.

  • Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a,  The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.
Species

Cynomolgus

Source

E. coli

Tag

Tag Free

Accession

XP_015292262.1 (M678-R751)

Gene ID

/

Molecular Construction
N-term
C5a (M678-R751)
Accession # XP_015292262.1
C-term
Synonyms
C5a; Complement Component 5a
AA Sequence

MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Complement C5/C5a Protein, Cynomolgus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement C5/C5a Protein, Cynomolgus
Cat. No.:
HY-P78595
Quantity:
MCE Japan Authorized Agent: