Complement C5/C5a Protein, Human

Complement C5/C5a Protein, Human is a recombinant human complement C5a. C5a is a 74-amino acid glycoprotein generated on activation of the C system. Complement C5 is cleaved by proteolysis in the terminal phase of complement activation generating the pro-inflammatory C5a and membrane attack complex nucleator C5b. C5a is an inflammatory mediator generated by complement activation that positively regulates various arms of immune defense, including Toll-like receptor 4 (TLR4) signaling^[1][2].

Complement component 5a (C5a) is a 74 amino acid glycoprotein and an important proinflammatory mediator that is cleaved enzymatically from its precursor, C5, on activation of the complement cascade. C5a is quickly metabolised by carboxypeptidases, forming the less-potent C5a desArg. C5a and C5a desArg interact with their receptors (C5aR and C5L2), which results in a number of effects which are essential to the immune response. C5a has a broad range of biological effects throughout the human body because the widespread expression of C5a receptors throughout the human organs enables C5a and C5a desArg to elicit a broad range of biological effects^[2].

1.Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a. The ED₅₀ is 41.72 ng/mL, corresponding to a specific activity is 2.39×10⁴ units/mg.
2.Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED₅₀ for this effect is 3.332-4.647 ng/mL, corresponding to a specific activity is 2.151-3.001×10⁵ units/mg.

• 
  Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a,  The ED₅₀ for this effect is 41.72 ng/mL，corresponding to a specific activity is 2.39×10⁴ units/mg.

Human

E. coli

Tag Free

P01031 (T678-R751)

727  [NCBI]

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. An G, et al. Role of C5a-C5aR axis in the development of atherosclerosis. Sci China Life Sci. 2014;57(8):790-794.  [Content Brief]

  [2]. Haggadone MD, et al. Bidirectional Crosstalk between C5a Receptors and the NLRP3 Inflammasome in Macrophages and Monocytes. Mediators Inflamm. 2016;2016:1340156.  [Content Brief]