Complement Factor D/Adipsin Protein, Mouse (HEK293, His)

Complement Factor D/Adipsin Protein cleaves factor B in complex with factor C3b, activating the C3bbb complex to form the C3 convertase in the alternate pathway, analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-6*His labeled tag.

Complement Factor D/Adipsin Protein functions by cleaving factor B, specifically when it is complexed with factor C3b. This cleavage activates the C3bbb complex, transforming it into the C3 convertase of the alternate pathway. The protein's role is homologous to that of C1s in the classical pathway.

Mouse

HEK293

C-6*His

P03953-1 (I26-S259)

11537  [NCBI]

ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS

40-49 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.