Complement Factor D/Adipsin Protein, Rat (P.pastoris, His)

Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is 238 a.a., with molecular weight (glycosylation form) of ~43 kDa.

Complement Factor D/Adipsin Protein performs a crucial role by cleaving factor B when it is in complex with factor C3b. This cleavage triggers the activation of the C3bbb complex, subsequently forming the C3 convertase of the alternate pathway. Importantly, its function is analogous to that of C1s in the classical pathway.

Rat

P. pastoris

N-6*His

P32038 (I26-A263)

54249  [NCBI]

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.