1. Recombinant Proteins
  2. Complement System
  3. Complement Regulatory Proteins
  4. Factor D
  5. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His)

Complement Factor D/Adipsin Protein, Rat (P.pastoris, His)

Cat. No.: HY-P71726
SDS COA Handling Instructions

Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is 238 a.a., with molecular weight (glycosylation form) of ~43 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $105 In-stock
10 μg $178 In-stock
50 μg $500 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is 238 a.a., with molecular weight (glycosylation form) of ~43 kDa.

Background

Complement Factor D/Adipsin Protein performs a crucial role by cleaving factor B when it is in complex with factor C3b. This cleavage triggers the activation of the C3bbb complex, subsequently forming the C3 convertase of the alternate pathway. Importantly, its function is analogous to that of C1s in the classical pathway.

Species

Rat

Source

P. pastoris

Tag

N-6*His

Accession

P32038 (I26-A263)

Gene ID
Molecular Construction
N-term
6*His
CFD (I26-A263)
Accession # P32038
C-term
Synonyms
Cfd; Adn; Df; Complement factor D; EC 3.4.21.46; Adipsin; C3 convertase activator; Endogenous vascular elastase; Properdin factor D
AA Sequence

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement Factor D/Adipsin Protein, Rat (P.pastoris, His)
Cat. No.:
HY-P71726
Quantity:
MCE Japan Authorized Agent: