Complement factor H/CFH Protein, Human (372a.a, HEK293, His)

Complement factor H/CFH proteins regulate complement activation and act as soluble inhibitors to prevent complement amplification on the cell surface. Complement factor H/CFH Protein, Human (372a.a, HEK293, His) is the recombinant human-derived Complement factor H/CFH protein, expressed by HEK293 , with C-His labeled tag.

Complement factor H (CFH) Protein, a glycoprotein, assumes a critical role in orchestrating a balanced immune response by finely modulating complement activation. Functioning as a soluble inhibitor, CFH's binding to self markers, such as glycan structures, effectively prevents complement activation and amplification on cell surfaces. It acts to accelerate the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus impeding the local formation of more C3b, a pivotal component in the complement amplification loop. Serving as a cofactor for the serine protease factor I, CFH additionally regulates the proteolytic degradation of already-deposited C3b. Beyond its role in complement regulation, CFH mediates various cellular responses through interactions with specific receptors. For instance, it engages with the CR3/ITGAM receptor, facilitating the adhesion of human neutrophils to diverse pathogens, leading to subsequent phagocytosis and destruction. Notably, in the context of microbial infection, CFH binds to the surface of P.falciparum gametocytes in the mosquito midgut, offering protection against elimination mediated by the alternative complement pathway. The multifaceted activities of CFH underscore its pivotal role in immune regulation and defense against pathogens.

Measured by its ability to bind biotinylated human DMP-1 in a functional ELISA.

Human

HEK293

C-His

P08603-1 (S860-R1231)

3075  [NCBI]

SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

55-60 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.