1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. COMT Protein, Human (His)

Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (His) is the recombinant human-derived COMT protein, expressed by E. coli , with N-6*His labeled tag. The total length of COMT Protein, Human (His) is 220 a.a., with molecular weight of 25-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

COMT Protein, Human (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (His) is the recombinant human-derived COMT protein, expressed by E. coli , with N-6*His labeled tag. The total length of COMT Protein, Human (His) is 220 a.a., with molecular weight of 25-28 kDa.

Background

Catechol-O-methyltransferase (COMT) is a crucial enzyme that catalyzes the O-methylation and subsequent inactivation of catecholamine neurotransmitters and catechol hormones. By mediating the transfer of a methyl group to these molecules, COMT plays a pivotal role in regulating the levels and activity of neurotransmitters such as dopamine, epinephrine, and norepinephrine. Beyond its involvement in catecholamine metabolism, COMT also shortens the biological half-lives of specific neuroactive drugs, including L-DOPA, alpha-methyl DOPA, and isoproterenol. This enzymatic activity is significant in modulating the pharmacokinetics of therapeutic agents targeting neurological and hormonal pathways. The regulatory role of COMT in both endogenous neurotransmitters and exogenous drugs highlights its importance in the fine-tuning of neurotransmission and drug responses, showcasing its broad impact on physiological and pharmacological processes.

Biological Activity

Measured by its ability to methylate catechol to O-methyl-catechol. The specific activity is 317.457 nmol/min/mg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P21964 (G52-P271)

Gene ID
Molecular Construction
N-term
6*His
COMT (G52-P271)
Accession # P21964
C-term
Synonyms
Catechol O methyltransferase; Catechol O-methyltransferase; COMT; COMT_HUMAN; EC 2.1.1.6
AA Sequence

GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Molecular Weight

25-28 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

COMT Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COMT Protein, Human (His)
Cat. No.:
HY-P72149
Quantity:
MCE Japan Authorized Agent: