COQ7 Protein, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of COQ7 Protein, Human (HEK293, His) is 181 a.a., with molecular weight of 19-22 kDa.

LpxC protein plays a pivotal role in lipid A biosynthesis by catalyzing the crucial and committed step involving the hydrolysis of UDP-3-O-myristoyl-N-acetylglucosamine. This enzymatic activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, marking a decisive point in the intricate process of lipid A synthesis. The ability of LpxC to precisely modulate this step underscores its significance in the regulation of lipid A production, a crucial component of bacterial lipopolysaccharides with implications for membrane integrity and pathogenicity.

Measured by its ablity of the fluorescence loss after oxidation NADH to NAD+. The specific activity is 73.920 pmol/min/mg in the presence of 250 μM NADH and 250 μM DMQ0 at 30℃.

Human

HEK293

C-6*His

Q99807-1 (S37-L217)

10229  [NCBI]

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Approximately 19-27 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.