1. Recombinant Proteins
  2. Others
  3. Corneodesmosin/CDSN Protein, Human (HEK293, His)

Corneodesmosin/CDSN Protein, Human (HEK293, His)

Cat. No.: HY-P7820
SDS COA Handling Instructions

PSORS1C1/CDSN, a keratin protein present in cornified desmosomes, is involved in the repair of human epidermis and other keratinized squamous epithelium. The expression of PSORS1C1/CDSN is associated with immune skin diseases such as psoriasis, and Cdsn deficiency causes skin barrier damage. Corneodesmosin/CDSN Protein, Human (HEK293, His) is the recombinant human-derived Corneodesmosin/CDSN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Corneodesmosin/CDSN Protein, Human (HEK293, His) is 496 a.a., with molecular weight of 58-70 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSORS1C1/CDSN, a keratin protein present in cornified desmosomes, is involved in the repair of human epidermis and other keratinized squamous epithelium. The expression of PSORS1C1/CDSN is associated with immune skin diseases such as psoriasis, and Cdsn deficiency causes skin barrier damage. Corneodesmosin/CDSN Protein, Human (HEK293, His) is the recombinant human-derived Corneodesmosin/CDSN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Corneodesmosin/CDSN Protein, Human (HEK293, His) is 496 a.a., with molecular weight of 58-70 kDa.

Background

PSORS1C1/CDSN is a corneodesmosin found in corneodesmosomes, which are localized in human epidermis and other keratinized squamous epithelium. PSORS1C1/CDSN is encoded by CDSN and primarily contributes to susceptibility to psoriasis, an immunodermatological disease. CDSN is polymorphic in the human population and is associated with ankylosing spondylitis (AS), psoriasis, hypotrichosis, and desquamation syndrome. Pediatric dermatosis, in particular, is caused by an autosomal recessive biallelic mutation in CDSN. In epidermal-specific Cdsn-deficient mouse models, epidermal barrier disruption occurs and epidermal cytokine production is increased.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH31993.1 (K33-P528)

Gene ID
Molecular Construction
N-term
CDSN (K33-P528)
Accession # AAH31993.1
6*His
C-term
Synonyms
rHuCorneodesmosin/CDSN, His; Corneodesmosin; S Protein; CDSN
AA Sequence

KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGNSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTSGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISSSSGSPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLDSP

Molecular Weight

58-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Corneodesmosin/CDSN Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Corneodesmosin/CDSN Protein, Human (HEK293, His)
Cat. No.:
HY-P7820
Quantity:
MCE Japan Authorized Agent: