Corneodesmosin/CDSN Protein, Human (HEK293, His)

PSORS1C1/CDSN, a keratin protein present in cornified desmosomes, is involved in the repair of human epidermis and other keratinized squamous epithelium. The expression of PSORS1C1/CDSN is associated with immune skin diseases such as psoriasis, and Cdsn deficiency causes skin barrier damage. Corneodesmosin/CDSN Protein, Human (HEK293, His) is the recombinant human-derived Corneodesmosin/CDSN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Corneodesmosin/CDSN Protein, Human (HEK293, His) is 496 a.a., with molecular weight of 58-70 kDa.

PSORS1C1/CDSN is a corneodesmosin found in corneodesmosomes, which are localized in human epidermis and other keratinized squamous epithelium. PSORS1C1/CDSN is encoded by CDSN and primarily contributes to susceptibility to psoriasis, an immunodermatological disease. CDSN is polymorphic in the human population and is associated with ankylosing spondylitis (AS), psoriasis, hypotrichosis, and desquamation syndrome. Pediatric dermatosis, in particular, is caused by an autosomal recessive biallelic mutation in CDSN. In epidermal-specific Cdsn-deficient mouse models, epidermal barrier disruption occurs and epidermal cytokine production is increased.

Human

HEK293

C-6*His

AAH31993.1 (K33-P528)

1041  [NCBI]

KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGNSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTSGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISSSSGSPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLDSP

58-70 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.