1. Recombinant Proteins
  2. Others
  3. CORS26 Protein, Mouse (Myc, His)

CORS26 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. CORS26 Protein involved in the LAMP1-STAT3, SIRT1/NF-魏B/p53, NF-魏B and TGF-尾1/Smad3 pathways play anti-inflammatory effects. CORS26 Protein also inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by toll-like receptors (TLR). CORS26 Protein, Mouse (Myc, His) is the recombinant mouse-derived CORS26 protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of CORS26 Protein, Mouse (Myc, His) is 224 a.a., with molecular weight of ~31.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CORS26 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. CORS26 Protein involved in the LAMP1-STAT3, SIRT1/NF-魏B/p53, NF-魏B and TGF-尾1/Smad3 pathways play anti-inflammatory effects. CORS26 Protein also inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by toll-like receptors (TLR). CORS26 Protein, Mouse (Myc, His) is the recombinant mouse-derived CORS26 protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of CORS26 Protein, Mouse (Myc, His) is 224 a.a., with molecular weight of ~31.1 kDa.

Background

C1q/ TNF-associated proteins (CTRPs) are a family of secreted proteins with a specific structure. Complement C1q tumor necrosis factor-related protein 3 shows anti-inflammatory action in psoriasis via the LAMP1-STAT3 axis. C1qtnf3 improves protein-induced severe acute pancreatitis in mice via the SIRT1/NF-κB/p53 axis. C1qtnf3 regulates NF-κB and TGF-β1/Smad3 pathways to reduce airway inflammation and remodeling in ovalbumin (OVA) -induced asthmatic mice. C1qtnf3 inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by Toll-like receptors (TLR)[1][2][3][4].

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc

Accession

Q9ES30 (23Q-246K)

Gene ID
Molecular Construction
N-term
10*His
CORS26 (23Q-246K)
Accession # Q9ES30
C-term
Synonyms
C1qtnf3; Cors26; Ctrp3; Complement C1q tumor necrosis factor-related protein 3; Collagenous repeat-containing sequence 26kDa protein; CORS26; Secretory protein CORS26
AA Sequence

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Weight

Approximately 31.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CORS26 Protein, Mouse (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CORS26 Protein, Mouse (Myc, His)
Cat. No.:
HY-P71639
Quantity:
MCE Japan Authorized Agent: