CRABP1 Protein, Human

The CRABP1 protein is present in the cytoplasm and is involved in regulating the entry of retinoic acid into nuclear retinoic acid receptors. As an important molecular player, CRABP1 may mediate the complex process of interaction between retinoic acid and its nuclear receptor. CRABP1 Protein, Human is the recombinant human-derived CRABP1 protein, expressed by E. coli , with tag free. The total length of CRABP1 Protein, Human is 137 a.a., with molecular weight of ~14 kDa.

Cellular Retinoic Acid-Binding Protein 1 (CRABP1) is a cytosolic protein known to play a role in regulating the access of retinoic acid to nuclear retinoic acid receptors. As part of the cellular retinoic acid-binding protein family, CRABP1 is involved in intracellular retinoid metabolism and signaling. Specifically, its cytosolic location suggests that it may act as a mediator in controlling the availability of retinoic acid to nuclear retinoic acid receptors, influencing the downstream effects of retinoic acid signaling. This regulatory function underscores the importance of CRABP1 in modulating the cellular responses to retinoic acid, a crucial signaling molecule involved in various physiological processes, including development and differentiation.

Human

E. coli

Tag Free

AAH22069.1 (M1-E137)

1381  [NCBI]

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Approximately 14 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 10% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.