Crlf1 Protein, Mouse (HEK293, His, solution)

Crlf1 protein combines with CLCF1 to form an important neurotrophic cytokine involved in neuronal development. It plays a crucial role in the initiation and maintenance of lactation in neonatal mice and is associated with immune system regulation. Crlf1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Crlf1 protein, expressed by HEK293 , with His labeled tag. The total length of Crlf1 Protein, Mouse (HEK293, His, solution) is 386 a.a., with molecular weight of ~75.0 kDa.

In conjunction with CLCF1, the Crlf1 protein forms a heterodimeric neurotropic cytokine crucial for neuronal development. It plays a vital role in the initiation and/or maintenance of suckling in neonatal mice and is implicated in potential regulatory functions within the immune system. Crlf1 protein exhibits the formation of covalent di- and tetramers, and it engages in the creation of a heteromeric complex with cardiotrophin-like cytokine CLCF1/CLC. This CRLF1-CLCF1 complex serves as a ligand for the ciliary neurotrophic factor receptor/CNTFR. Notably, the CRLF1-CLCF1 heterodimer, along with the tripartite signaling complex formed by CRLF1, CLCF1, and CNTFR, binds SORL1, where the interaction is predominantly mediated by the CRLF1 moiety within this complex. These intricate interactions underscore the multifaceted roles of Crlf1 protein in both neurodevelopmental processes and immune regulation.

Mouse

HEK293

His

Q9JM58 (G40-G425)

12931  [NCBI]

GAHTAVISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAARGPAG

Approximately 75.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.