CRTAM/CD355 Protein, Cynomolgus (HEK293, His)

CRTAM/CD355 Protein is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. CRTAM takes part in cellular adhesion, polarity, and proliferation. CRTAM also regulates lymphocyte function, and promotes TCD8+ cell adhesion and retention within the lymph node. Furthermore, CRTAM can interact with Necl-2, and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, and NK cell-mediated rejection of tumors expressing Necl-2 in vivo^[1][2]sup>[3]^[4]. CRTAM/CD355 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

Class I-restricted T cell-associated molecule (CRTAM) is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also known as CD355 or cytotoxic and regulatory T-cell molecule (expressed by activated CD8+ and NK T cells). In addition, CRTAM is expressed in several non-immune tissues, including liver, lung, testis, kidney, intestine, and brain. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. Noticeably, activated T cells and NK cells only transiently express CRTAM^[1][3].
CRTAM takes part in kinds of signaling pathways, including cellular adhesion, polarity, and proliferation. CRTAM regulates lymphocyte function, and also promotes TCD8+ cell adhesion and retention within the lymph node. Besides, it induces a late phase of cell polarity during activation and regulates effector function in a small subset of TCD4 cells^[1][2]. Furthermore, CRTAM can interact with Necl-2 (a ligand for CRTAM), and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, as well as NK cell-mediated rejection of tumors expressing Necl-2 in vivo. CRTAM shows some sequence homology to nectins and Necls^[3][4].

Cynomolgus

HEK293

C-6*His

XP_005580021.1 (S18-G287)

102125896  [NCBI]

SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG

50-60 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.