1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO)

CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO)

Cat. No.: HY-P71473
Handling Instructions Technical Support

CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssB is also required for stabilization of CssA, maximal adhesion of E.coli to epithelial cells and CS6 assembly. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived CS6 fimbrial subunit B/cssB protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is 146 a.a., with molecular weight of ~31.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssB is also required for stabilization of CssA, maximal adhesion of E.coli to epithelial cells and CS6 assembly. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived CS6 fimbrial subunit B/cssB protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is 146 a.a., with molecular weight of ~31.9 kDa.

Background

CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssA can inhibit the CssB-mediated binding as another structural subunit of CS6. CssB is also required for stabilization of CssA, while all css genes are necessary for maximal adhesion of E.coli to epithelial cells and CS6 assembly[1].

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

P53510 (G22-N167)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
cssB (G22-N167)
Accession # P53510
C-term
Synonyms
cssBCS6 fimbrial subunit B
AA Sequence

GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Molecular Weight

Approximately 31.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71473
Quantity:
MCE Japan Authorized Agent: