1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. CSAD Protein, Mouse (His-SUMO)

CSAD proteins play a crucial role in the metabolism of sulfur-containing amino acids, catalyzing L-aspartate, 3-sulfinyl-L-alanine (cysteine sulfenic acid) and L-cysteine The acid is decarboxylated to produce β-alanine, hypotaurine and taurine respectively. Among these substrates, 3-sulfinyl-L-alanine is the preferred substrate for CSAD. CSAD Protein, Mouse (His-SUMO) is the recombinant mouse-derived CSAD protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CSAD Protein, Mouse (His-SUMO) is 493 a.a., with molecular weight of ~71.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CSAD proteins play a crucial role in the metabolism of sulfur-containing amino acids, catalyzing L-aspartate, 3-sulfinyl-L-alanine (cysteine sulfenic acid) and L-cysteine The acid is decarboxylated to produce β-alanine, hypotaurine and taurine respectively. Among these substrates, 3-sulfinyl-L-alanine is the preferred substrate for CSAD. CSAD Protein, Mouse (His-SUMO) is the recombinant mouse-derived CSAD protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CSAD Protein, Mouse (His-SUMO) is 493 a.a., with molecular weight of ~71.1 kDa.

Background

Cysteine sulfinic acid decarboxylase (CSAD) is an enzyme that catalyzes the decarboxylation of three substrates: L-aspartate, 3-sulfino-L-alanine (cysteine sulfinic acid), and L-cysteate, resulting in the production of beta-alanine, hypotaurine, and taurine, respectively. Among these substrates, CSAD shows a preference for 3-sulfino-L-alanine. Notably, the enzyme does not exhibit any decarboxylation activity toward glutamate. The diverse substrate specificity of CSAD suggests its involvement in the biosynthesis of important metabolites, such as taurine and beta-alanine, which play roles in various physiological processes, including bile salt formation and neurotransmission. It has to highlight CSAD's ability to selectively decarboxylate specific substrates, shedding light on its significance in the cellular metabolism of sulfur-containing amino acids.

Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q9DBE0 (M1-L493)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CSAD (M1-L493)
Accession # Q9DBE0
C-term
Synonyms
CsadCysteine sulfinic acid decarboxylase; EC 4.1.1.29; Aspartate 1-decarboxylase; EC 4.1.1.11; Cysteine-sulfinate decarboxylase; Sulfinoalanine decarboxylase
AA Sequence

MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL

Molecular Weight

Approximately 71.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CSAD Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CSAD Protein, Mouse (His-SUMO)
Cat. No.:
HY-P72151
Quantity:
MCE Japan Authorized Agent: