1. Recombinant Proteins
  2. Others
  3. CSAG1 Protein, Human (HEK293, Fc)

CSAG1 Protein is a potential key player in maintaining centrosome integrity during mitosis, impacting chromosome segregation. The mechanisms underlying its contribution to centrosome stability require elucidation. Its putative involvement highlights significance in mitosis-related cellular events. Further research is essential to unravel precise details of CSAG1's function and its implications for centrosome integrity during mitosis. CSAG1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSAG1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CSAG1 Protein, Human (HEK293, Fc) is 59 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CSAG1 Protein is a potential key player in maintaining centrosome integrity during mitosis, impacting chromosome segregation. The mechanisms underlying its contribution to centrosome stability require elucidation. Its putative involvement highlights significance in mitosis-related cellular events. Further research is essential to unravel precise details of CSAG1's function and its implications for centrosome integrity during mitosis. CSAG1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSAG1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CSAG1 Protein, Human (HEK293, Fc) is 59 a.a., with molecular weight of ~34 kDa.

Background

CSAG1 Protein emerges as a potential key player, suggesting its crucial role in maintaining centrosome integrity during mitosis. The specific mechanisms and molecular interactions through which CSAG1 contributes to the intricate processes associated with centrosome stability remain to be fully elucidated. Its putative involvement underscores its significance in cellular events related to mitosis, indicating a potential impact on the proper segregation of chromosomes and overall cell division. Further research is essential to unravel the precise details of CSAG1's function and its implications in ensuring the integrity and functionality of centrosomes during the dynamic process of mitosis.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q6PB30-1 (D20-P78)

Gene ID
Molecular Construction
N-term
hFc
CSAG1 (D20-P78)
Accession # Q6PB30
C-term
Synonyms
Putative chondrosarcoma-associated gene 1 protein; CT24.1; Cancer/testis antigen CSAGE; CSAGE
AA Sequence

DQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTKGSP

Molecular Weight

Approximately 34 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CSAG1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CSAG1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76849
Quantity:
MCE Japan Authorized Agent: