CSTL1 Protein, Human (HEK293, Fc)

Cystatin-like protein 1 (CSTL1) is a member of the cystatin family. CSTL1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSTL1 protein, expressed by HEK293 , with C-hFc labeled tag.

CSTL1 Protein is a type 2 cystatin-like protein. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The specific function of this protein has not been determined. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens.

Human

HEK293

C-hFc

Q9H114 (A20-R145)

128817  [NCBI]

AKLGHFQRWEGFQQKLMSKKNMNSTLNFFIQSYNNASNDTYLYRVQRLIRSQMQLTTGVEYIVTVKIGWTKCKRNDTSNSSCPLQSKKLRKSLICESLIYTMPWINYFQLWNNSCLEAEHVGRNLR

Approximately 45-80 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.