1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. CTGF
  5. CCN2/CTGF Protein, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free. The total length of CCN2/CTGF Protein, Human (HEK293) is 154 a.a., with molecular weight of ~21.15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

CCN2/CTGF Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE CCN2/CTGF Protein, Human (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free. The total length of CCN2/CTGF Protein, Human (HEK293) is 154 a.a., with molecular weight of ~21.15 kDa.

Background

CCN2/CTGF (Connective Tissue Growth Factor) is a protein primarily produced by vascular endothelial cells. It plays a significant role in various cellular processes. One of its main functions is to attract and stimulate the proliferation and differentiation of chondrocytes, which are cells involved in the formation of cartilage. Additionally, CCN2/CTGF mediates cell adhesion in various cell types, including fibroblasts, myofibroblasts, endothelial cells, and epithelial cells. This adhesion is dependent on the presence of heparin (a polysaccharide) and divalent cations (such as calcium or magnesium). Furthermore, CCN2/CTGF enhances the DNA synthesis induced by fibroblast growth factors, which are proteins involved in cell growth and repair. Overall, CCN2/CTGF is an important protein that regulates cellular processes such as chondrocyte function, cell adhesion, and DNA synthesis, contributing to the development and maintenance of connective tissues.

Biological Activity

Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion.The ED50 this effect is 0.5-1.5 μg/mL.

  • Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion.The ED50 this effect is 0.8781 μg/mL, corresponding to a specific activity is 1.139×103 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q5M8T4 (Q27-A180)

Gene ID
Molecular Construction
N-term
CTGF (Q27-A180)
Accession # Q5M8T4
C-term
Synonyms
rHuConnective tissue growth factor/CTGF; Connective tissue growth factor; CCN family member 2; Hypertrophic chondrocyte-specific protein 24; Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8
AA Sequence

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Molecular Weight

Approximately 19-25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CCN2/CTGF Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCN2/CTGF Protein, Human (HEK293)
Cat. No.:
HY-P70106
Quantity:
MCE Japan Authorized Agent: