CCN2/CTGF Protein, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free. The total length of CCN2/CTGF Protein, Human (HEK293) is 154 a.a., with molecular weight of ~21.15 kDa.

CCN2/CTGF (Connective Tissue Growth Factor) is a protein primarily produced by vascular endothelial cells. It plays a significant role in various cellular processes. One of its main functions is to attract and stimulate the proliferation and differentiation of chondrocytes, which are cells involved in the formation of cartilage. Additionally, CCN2/CTGF mediates cell adhesion in various cell types, including fibroblasts, myofibroblasts, endothelial cells, and epithelial cells. This adhesion is dependent on the presence of heparin (a polysaccharide) and divalent cations (such as calcium or magnesium). Furthermore, CCN2/CTGF enhances the DNA synthesis induced by fibroblast growth factors, which are proteins involved in cell growth and repair. Overall, CCN2/CTGF is an important protein that regulates cellular processes such as chondrocyte function, cell adhesion, and DNA synthesis, contributing to the development and maintenance of connective tissues.

Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion.The ED₅₀ this effect is 0.8781 μg/mL, corresponding to a specific activity is 1.139×10³ units/mg.

• 
  Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion.The ED₅₀ this effect is 0.8781 μg/mL, corresponding to a specific activity is 1.139×10³ units/mg.

Human

HEK293

Tag Free

Q5M8T4 (Q27-A180)

1490  [NCBI]

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Approximately 21.15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.