CTHRC1 Protein, Rat (HEK293, His)

CTHRC1, with predicted Wnt-protein and frizzled binding activity, influences cell migration. Located in the extracellular matrix, this protein, implicated in Barrett's esophagus, exhibits biased expression in lung (RPKM 46.1) and muscle (RPKM 36.6), suggesting its role in diverse physiological processes across tissues. CTHRC1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTHRC1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CTHRC1 Protein, Rat (HEK293, His) is 230 a.a., with molecular weight of ~27 KDa.

CTHRC1, a protein predicted to possess Wnt-protein binding activity and frizzled binding activity, operates upstream of or within the process of cell migration. This protein is located in the extracellular matrix, and its human ortholog(s) have been implicated in Barrett's esophagus. With biased expression observed in tissues such as lung (RPKM 46.1) and muscle (RPKM 36.6), CTHRC1 may play a significant role in diverse physiological processes across different tissues.

Rat

HEK293

C-6*His

NP_001258229 (S33-K230)

282836  [NCBI]

SENPKYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Approximately 27 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.