CTLA-4 Protein, Rhesus Macaque (HEK293, Fc)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-hFc labeled tag.

CTLA-4 protein functions as a primary inhibitory receptor, exerting a crucial role as a major negative regulator in T-cell responses. The distinguishing feature of CTLA-4 lies in its considerably stronger affinity for its natural B7 family ligands, CD80 and CD86, compared to the affinity of their corresponding stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively counterbalance and suppress T-cell activation, contributing to the intricate regulation of immune responses. The dynamic interplay between CTLA-4 and its ligands underscores its significance in fine-tuning the immune system and maintaining a delicate equilibrium between activation and inhibition in T-cell-mediated immunity.

Rhesus Macaque

HEK293

C-hFc

Q9BDC4 (A37-D161)

705673  [NCBI]

MACLGFQRHKARLNLATRTRPYTLLFSLLFIPVFSKAMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Approximately 52 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.