CTLA-4 Protein, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

CTLA-4 protein functions as a primary inhibitory receptor, exerting a crucial role as a major negative regulator in T-cell responses. The distinguishing feature of CTLA-4 lies in its considerably stronger affinity for its natural B7 family ligands, CD80 and CD86, compared to the affinity of their corresponding stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively counterbalance and suppress T-cell activation, contributing to the intricate regulation of immune responses. The dynamic interplay between CTLA-4 and its ligands underscores its significance in fine-tuning the immune system and maintaining a delicate equilibrium between activation and inhibition in T-cell-mediated immunity.

Measured by its binding ability in a functional ELISA. Immobilized recombinant cynomolgus monkey CTLA-4 at 0.5 μg/mL (100 μL/well) can bind biotinylated recombinant human B7-1. The ED₅₀ for this effect is 287.2 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized recombinant cynomolgus monkey CTLA-4 at 0.5 μg/mL (100 μL/well) can bind biotinylated recombinant human B7-1 .The ED₅₀ for this effect is 287.2 ng/mL.

Rhesus Macaque

HEK293

C-His

Q9BDC4 (A37-D161)

705673  [NCBI]

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Approximately 25-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.