CXADR Protein, Human (HEK293, His)

CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CXADR Protein, Human (HEK293, His) is 218 a.a., with molecular weight of ~32.0 kDa.

CXADR protein plays a pivotal role as a component of the epithelial apical junction complex, essential for maintaining tight junction integrity by functioning as a homophilic cell adhesion molecule. Beyond its structural role, CXADR is actively involved in facilitating the transepithelial migration of leukocytes through adhesive interactions with JAML, a transmembrane protein on the plasma membrane of leukocytes. This interaction not only supports the physical process of leukocyte migration but also serves as a key mediator for the activation of gamma-delta T-cells, a specialized T-cell subpopulation residing in epithelial tissues crucial for tissue homeostasis and repair. Upon binding to CXADR, JAML initiates downstream cell signaling events in gamma-delta T-cells, involving PI3-kinase and MAP kinases, leading to T-cell proliferation and the production of cytokines and growth factors. This cascade of events contributes to the stimulation of epithelial tissue repair. Notably, in the context of microbial infection, CXADR acts as a receptor for adenovirus type C.

Human

HEK293

C-6*His

P78310/NP_001329.1 (L20-G237)

1525  [NCBI]

LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG

Approximately 32.0 kDa

Greater than 92% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2. (Due to the optimization of production process, the components of different batches may vary slightly.)

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.