1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Coxsackievirus and Adenovirus Receptor (CXADR)
  6. CXADR Protein, Human (HEK293, His)

CXADR Protein, Human (HEK293, His)

Cat. No.: HY-P70049
SDS COA Handling Instructions

CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CXADR Protein, Human (HEK293, His) is 218 a.a., with molecular weight of ~32.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CXADR Protein, Human (HEK293, His) is 218 a.a., with molecular weight of ~32.0 kDa.

Background

CXADR protein plays a pivotal role as a component of the epithelial apical junction complex, essential for maintaining tight junction integrity by functioning as a homophilic cell adhesion molecule. Beyond its structural role, CXADR is actively involved in facilitating the transepithelial migration of leukocytes through adhesive interactions with JAML, a transmembrane protein on the plasma membrane of leukocytes. This interaction not only supports the physical process of leukocyte migration but also serves as a key mediator for the activation of gamma-delta T-cells, a specialized T-cell subpopulation residing in epithelial tissues crucial for tissue homeostasis and repair. Upon binding to CXADR, JAML initiates downstream cell signaling events in gamma-delta T-cells, involving PI3-kinase and MAP kinases, leading to T-cell proliferation and the production of cytokines and growth factors. This cascade of events contributes to the stimulation of epithelial tissue repair. Notably, in the context of microbial infection, CXADR acts as a receptor for adenovirus type C.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P78310/NP_001329.1 (L20-G237)

Gene ID
Molecular Construction
N-term
CXADR (L20-G237)
Accession # P78310
6*His
C-term
Synonyms
rHuCoxsackievirus and adenovirus receptor/CXADR, His ; Coxsackievirus and Adenovirus Receptor; CAR; hCAR; CVB3-Binding Protein; Coxsackievirus B-Adenovirus Receptor; HCVADR; CXADR; CAR
AA Sequence

LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 92% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2. (Due to the optimization of production process, the components of different batches may vary slightly.)

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXADR Protein, Human (HEK293, His)
Cat. No.:
HY-P70049
Quantity:
MCE Japan Authorized Agent: