CXADR Protein, Mouse (HEK293, Fc)

CXADR protein is a key component of the epithelial apical junction complex, which maintains the integrity of tight junctions and enables leukocyte migration through adhesive interactions with JAML. This interaction activates γ-δ T cells and promotes tissue repair through cell signaling involving PI3 kinase and MAP kinase. CXADR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CXADR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CXADR Protein, Mouse (HEK293, Fc) is 218 a.a., with molecular weight of 50-70 kDa.

As a vital component of the epithelial apical junction complex, CXADR serves a dual role in maintaining tight junction integrity as a homophilic cell adhesion molecule and facilitating the transepithelial migration of leukocytes through adhesive interactions with Junctional Adhesion Molecule-Like (JAML), a transmembrane protein on the plasma membrane of leukocytes. This interaction between CXADR and JAML is pivotal for the activation of gamma-delta T-cells, a specialized T-cell subpopulation residing in epithelial tissues, contributing to tissue homeostasis and repair. Upon binding to CXADR, JAML initiates downstream cell signaling in gamma-delta T-cells through pathways involving PI3-kinase and MAP kinases, resulting in T-cell proliferation and the production of cytokines and growth factors. This, in turn, stimulates the repair of epithelial tissues. CXADR may exist as a monomer or form homodimers, and it interacts with various proteins, including LNX, MAGI1, DLG4, PRKCABP, TJP1, CTNNB1, and MPDZ, with the latter recruiting MPDZ to intercellular contact sites. Additionally, CXADR engages in homodimeric interactions with JAML, contributing to its multifaceted cellular functions.

Mouse

HEK293

C-hFc

P97792 (L20-G237)

13052  [NCBI]

LSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAG

50-70 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Or lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.