IP-10/CXCL10 Protein, Rhesus macaque (His)

CXCL10 protein acts as a chemotactic factor for monocytes and T-lymphocytes, playing a crucial role in their migration in response to inflammatory signals. Through binding to CXCR3, CXCL10 selectively attracts monocytes and T-lymphocytes, positioning it as a key player in immune responses, contributing to the recruitment and activation of these immune cells in various physiological and pathological contexts. IP-10/CXCL10 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL10 protein, expressed by E. coli , with N-6*His labeled tag.

CXCL10 protein serves as a chemotactic factor for both monocytes and T-lymphocytes, playing a crucial role in orchestrating their migration in response to inflammatory signals. Through its binding to CXCR3, CXCL10 establishes a molecular interaction that facilitates its chemoattraction functions. This selective chemotaxis for monocytes and T-lymphocytes positions CXCL10 as a key player in the immune response, contributing to the recruitment and activation of these immune cells within various physiological and pathological contexts.

Measured in a cytotoxicity assay using HUVEC Human Umbilical Vein Endothelial Cells. The ED₅₀ for this effect is 42.55 pg/mL, corresponding to a specific activity is 2.350×10⁷ units/mg.

• 
  Measured in a cytotoxicity assay using HUVEC Human Umbilical Vein Endothelial Cells. The ED₅₀ for this effect is 42.55 pg/mL, corresponding to a specific activity is 2.350×10⁷ units/mg.

Rhesus Macaque

E. coli

N-6*His

Q8MIZ1 (I22-P98)

574243  [NCBI]

IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.