I-TAC/CXCL11 Protein, Mouse

The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.

CXCL11 protein exhibits specific chemotactic activity for interleukin-activated T-cells but not for unstimulated T-cells, neutrophils, or monocytes. Its capacity to induce calcium release specifically in activated T-cells suggests a targeted role in the immune response. By binding to CXCR3, CXCL11 is intricately involved in T-cell chemotaxis, indicating its potential significance in diseases of the central nervous system that involve T-cell recruitment. Furthermore, CXCL11 may contribute to skin immune responses, as inferred by similarities in its function. The interaction of CXCL11 with TNFAIP6 via the Link domain suggests a regulatory role, emphasizing its involvement in modulating chemokine activity within complex cellular microenvironments.

Mouse

E. coli

Tag Free

Q9JHH5 (F22-M100)

56066  [NCBI]

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Approximately 11 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.