CXCL14/BRAK Protein, Mouse (His)

CXCL14/BRAK protein selectively attracts CESS B cells and THP-1 monocytes without affecting T cells. Its specific chemical attraction emphasizes its role in mediating B cell and monocyte migration, contributing to immune responses within the microenvironment. CXCL14/BRAK Protein, Mouse (His) is the recombinant mouse-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL14/BRAK Protein, Mouse (His) is 77 a.a., with molecular weight of ~13 kDa.

CXCL14/BRAK protein functions as a chemotactic factor specifically attracting CESS B-cells and THP-1 monocytes, with no chemotactic effect on T-cells. This selective chemoattraction underscores its role in mediating the migration of B-cells and monocytes, contributing to immune responses within the microenvironment. The distinct chemotactic properties of CXCL14/BRAK highlight its specificity for certain immune cell types, suggesting a specialized role in regulating the recruitment and activation of B-cells and monocytes while not influencing T-cell migration.

The biological activity determined by a chemotaxis bioassay using THP-1 human monocytic leukemia cells.The ED₅₀ for this effect is 1.081 ng/mL, corresponding to a specific activity is 9.25×10⁵ units/mg.

• 
  The biological activity determined by a chemotaxis bioassay using THP-1 human monocytic leukemia cells.The ED₅₀ for this effect is 1.081 ng/mL, corresponding to a specific activity is 9.25×10⁵ units/mg.

Mouse

E. coli

N-6*His

Q9WUQ5 (S23-E99)

57266  [NCBI]

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Approximately 13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 300 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.