CXCL14/BRAK Protein, Rat (N-His)

The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED₅₀ for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×10⁵ units/mg.

• 
  The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED₅₀ for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×10⁵ units/mg.

Rat

E. coli

N-6*His

Q8K453 (S23-E99)

306748  [NCBI]

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Approximately12 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.