CXCL17 Protein, Human

The CXCL17 protein is a chemokine that attracts monocytes, macrophages, and dendritic cells and plays a role in angiogenesis and potential tumor development. CXCL17 Protein, Human is the recombinant human-derived CXCL17 protein, expressed by E. coli , with tag free. The total length of CXCL17 Protein, Human is 98 a.a., with molecular weight of ~11.5 kDa.

CXCL17 protein functions as a chemokine with chemoattractant properties for monocytes, macrophages, and dendritic cells, as demonstrated in various studies. Its involvement extends to angiogenesis and potentially tumor development, emphasizing its role in complex physiological processes. In the stomach, CXCL17 acts as an anti-inflammatory agent, contributing to local immune regulation. Additionally, there is a suggestion that CXCL17 may participate in the innate defense against infections, broadening its significance in immune responses. Through its interaction with the C-X-C chemokine receptor GPR35, CXCL17 induces a rapid and transient increase in intracellular calcium ions, adding a layer of specificity to its signaling mechanisms. Notably, CXCL17 exhibits a considerably higher chemoattractant potency on monocytes and macrophages compared to 6-Cys CXCL17, underscoring its distinct functional characteristics.

Human

E. coli

Tag Free

Q6UXB2 (S22-L119)

284340  [NCBI]

SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Approximately 11.5 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.