CYBB/Nox2 Protein, Human (His)

The CYBB/Nox2 protein is an important membrane-bound oxidase in phagocytes and is critical for superoxide production. As the terminal element of the respiratory chain, it transfers a single electron from NADPH to molecular oxygen. CYBB/Nox2 Protein, Human (His) is the recombinant human-derived CYBB/Nox2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CYBB/Nox2 Protein, Human (His) is 288 a.a., with molecular weight of ~37.2 kDa.

CYBB/Nox2 protein serves as a crucial component of the membrane-bound oxidase found in phagocytes, playing a pivotal role in the generation of superoxide. As the terminal element of a respiratory chain, it facilitates the transfer of single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Additionally, CYBB/Nox2 operates as a voltage-gated proton channel, orchestrating H(+) currents in resting phagocytes. Its involvement extends to the regulation of cellular pH, and notably, this function is modulated by zinc, which serves as a blocking agent for the channel. The multifaceted activities of CYBB/Nox2 underscore its significance in the intricate cellular processes associated with oxidative and protonic regulation within phagocytes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P04839 (E283-F570)

1536  [NCBI]

ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Approximately 37 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.