1. Recombinant Proteins
  2. Others
  3. Cyclin-H/CCNH Protein, Human (His)

Cyclin-H/CCNH plays a key role as a modulator of CDK7, the catalytic subunit of the CDK-activated kinase (CAK) complex. This enzyme complex activates cyclin-related kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. Cyclin-H/CCNH Protein, Human (His) is the recombinant human-derived Cyclin-H/CCNH protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cyclin-H/CCNH Protein, Human (His) is 323 a.a., with molecular weight of 34-39 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclin-H/CCNH plays a key role as a modulator of CDK7, the catalytic subunit of the CDK-activated kinase (CAK) complex. This enzyme complex activates cyclin-related kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. Cyclin-H/CCNH Protein, Human (His) is the recombinant human-derived Cyclin-H/CCNH protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cyclin-H/CCNH Protein, Human (His) is 323 a.a., with molecular weight of 34-39 kDa.

Background

The Cyclin-H/CCNH protein functions as a pivotal regulator of CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK, in turn, plays a crucial role in activating cyclin-associated kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. In association with the core-TFIIH basal transcription factor, CAK facilitates RNA polymerase II activation by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing the polymerase to escape from the promoter and initiate transcript elongation. Cyclin-H/CCNH is actively involved in cell cycle control and RNA transcription by RNA polymerase II, with its expression and activity remaining constant throughout the cell cycle. It primarily associates with CDK7 and MAT1 to form the CAK complex, which, in turn, can further associate with the core-TFIIH to constitute the TFIIH basal transcription factor. These regulatory interactions highlight Cyclin-H/CCNH's central role in coordinating key cellular processes essential for proper cell cycle progression and transcriptional control.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P51946 (M1-L323)

Gene ID

902  [NCBI]

Molecular Construction
N-term
6*His
CCNH (M1-L323)
Accession # P51946
C-term
Synonyms
rHuCyclin-H/CCNH, His; Cyclin-H; CCNH; MO15-associated protein; p34; p37
AA Sequence

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Molecular Weight

34-39 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, 2 mM DTT, 30% Glycerol, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cyclin-H/CCNH Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclin-H/CCNH Protein, Human (His)
Cat. No.:
HY-P70041
Quantity:
MCE Japan Authorized Agent: