1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Cyclophilin A Protein, Mouse (solution)

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse (solution) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free. The total length of Cyclophilin A Protein, Mouse is 164 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse (solution) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free. The total length of Cyclophilin A Protein, Mouse is 164 a.a., with molecular weight of ~17.0 kDa.

Background

Cyclophilin A catalyzes the cis-trans isomerization of proline imidic peptide bonds, exerting a potent chemotactic effect on leukocytes through the activation of its membrane receptor BSG/CD147 and initiating a signaling cascade culminating in MAPK/ERK activation. This protein activates endothelial cells (ECs) in a pro-inflammatory manner by stimulating NF-kappa-B and MAP-kinase signaling, inducing the expression of adhesion molecules like SELE and VCAM1. Moreover, Cyclophilin A induces apoptosis in ECs by promoting FOXO1-dependent expression of CCL2 and BCL2L11. In response to oxidative stress, it initiates both proapoptotic and antiapoptotic signaling pathways in ECs through NF-kappa-B activation, AKT1 up-regulation, and BCL2 induction. It negatively regulates MAP3K5/ASK1 kinase activity and is essential for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, thereby influencing TARDBP binding to RNA and the expression of HDAC6, ATG7, and VCP, crucial for protein aggregate clearance. Cyclophilin A also plays a pivotal role in platelet activation and aggregation, regulates calcium mobilization, integrin ITGA2B:ITGB3 bidirectional signaling, and binds heparan sulfate glycosaminoglycans.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P17742 (M1-L164)

Gene ID
Molecular Construction
N-term
Cyclophilin A (M1-L164)
Accession # P17742
C-term
Synonyms
rMuPeptidyl-prolyl cis-trans isomerase A/Cyclophilin A; Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A; SP18; PPIA; CYPA
AA Sequence

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cyclophilin A Protein, Mouse (solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclophilin A Protein, Mouse (solution)
Cat. No.:
HY-P70007
Quantity:
MCE Japan Authorized Agent: