1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Cyclophilin F/PPIF Protein, Human (HEK293, His)

Cyclophilin F/PPIF Protein, Human (HEK293, His)

Cat. No.: HY-P74211A
Handling Instructions Technical Support

Cyclophilin F/PPIF protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of proline imide peptide bonds and may contribute to protein folding. It critically regulates the mitochondrial permeability transition pore (mPTP), affecting cell apoptosis or necrosis. Cyclophilin F/PPIF Protein, Human (HEK293, His) is the recombinant human-derived Cyclophilin F/PPIF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cyclophilin F/PPIF Protein, Human (HEK293, His) is 178 a.a., with molecular weight of ~24-34 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclophilin F/PPIF protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of proline imide peptide bonds and may contribute to protein folding. It critically regulates the mitochondrial permeability transition pore (mPTP), affecting cell apoptosis or necrosis. Cyclophilin F/PPIF Protein, Human (HEK293, His) is the recombinant human-derived Cyclophilin F/PPIF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cyclophilin F/PPIF Protein, Human (HEK293, His) is 178 a.a., with molecular weight of ~24-34 kDa.

Background

Cyclophilin F/PPIF Protein functions as a peptidyl-prolyl cis-trans isomerase (PPIase), playing a vital role in catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, thereby potentially facilitating protein folding. Beyond its involvement in protein folding, Cyclophilin F/PPIF is a key player in the regulation of the mitochondrial permeability transition pore (mPTP), where its association with the mPTP is suggested to mask a binding site for inhibiting inorganic phosphate (Pi), ultimately promoting the open probability of the mPTP and leading to apoptosis or necrosis; however, the requirement for PPIase activity in this process is a matter of debate. Additionally, in collaboration with mitochondrial p53/TP53, Cyclophilin F/PPIF contributes to the activation of oxidative stress-induced necrosis. It further participates in modulating mitochondrial membrane F(1)F(0) ATP synthase activity and regulating mitochondrial matrix adenine nucleotide levels. Exhibiting anti-apoptotic activity independently of the mPTP, Cyclophilin F/PPIF, in cooperation with BCL2, effectively inhibits cytochrome c-dependent apoptosis, highlighting its multifaceted roles in mitochondrial function and cell survival mechanisms.

Biological Activity

Measured by its ability to convert the 0.3 mM substrate of Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 1004.301 pmol/min/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P30405 (C30-S207)

Gene ID

10105

Molecular Construction
N-term
PPIF (C30-S207)
Accession # P30405
6*His
C-term
Synonyms
Peptidyl-prolyl cis-trans isomerase; PPIase; PPIF
AA Sequence

CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

Molecular Weight

Approximately 24-34 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cyclophilin F/PPIF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclophilin F/PPIF Protein, Human (HEK293, His)
Cat. No.:
HY-P74211A
Quantity:
MCE Japan Authorized Agent: