Cystatin A/CSTA Protein, Human (His)

Cystatin A (CSTA) protein is an intracellular thiol protease inhibitor critical for desmosome-mediated intercellular adhesion, especially in the epidermis. Its role as a protease inhibitor is essential for regulating cellular proteolytic activity. Cystatin A/CSTA Protein, Human (His) is the recombinant human-derived Cystatin A/CSTA protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cystatin A/CSTA Protein, Human (His) is 97 a.a., with molecular weight of ~14.0 kDa.

Cystatin A (CSTA) protein serves as an intracellular thiol proteinase inhibitor and plays a crucial role in desmosome-mediated cell-cell adhesion, particularly in the lower levels of the epidermis. Its function as a proteinase inhibitor underscores its significance in regulating proteolytic activities within cells. Moreover, the specific involvement of CSTA in desmosome-mediated adhesion highlights its essential contribution to the structural integrity and cohesion of epidermal cells. The intricate interplay of CSTA within cellular processes emphasizes its importance in maintaining the functional and structural aspects of the epidermis, particularly in the context of cell adhesion mechanisms.

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. The IC₅₀ value is 0.408 nM, as measured under the described conditions.

Human

E. coli

N-6*His

P01040 (I2-F98)

1475  [NCBI]

IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.