1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin C
  5. Cystatin C/CST3 Protein, Human (HEK293)

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with tag free. The total length of Cystatin C/CST3 Protein, Human (HEK293) is 120 a.a., with molecular weight of ~15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Cystatin C/CST3 Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with tag free. The total length of Cystatin C/CST3 Protein, Human (HEK293) is 120 a.a., with molecular weight of ~15 kDa.

Background

The Cystatin C/CST3 protein serves a crucial physiological role as an inhibitor of cysteine proteinases, acting as a local regulator of their enzyme activity. It is known to capture and bind free plasma hemoglobin, preventing kidney damage and enabling the hepatic recycling of heme iron. In cases of hemolysis, where hemoglobin can accumulate in the kidneys and be secreted in urine, Cystatin C/CST3 plays a vital role in clearing the complexes formed between hemoglobin and Haptoglobin. Additionally, Cystatin C/CST3 acts as an antioxidant, exhibits antibacterial activity, and contributes to modulating various aspects of the acute phase response. The protein's homodimeric structure further enhances its functionality and effectiveness as an enzyme inhibitor.

Biological Activity

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. The IC50 value is 2.151 nM.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P01034 (S27-A146)

Gene ID
Molecular Construction
N-term
CST3 (S27-A146)
Accession # P01034
C-term
Synonyms
Cystatin-C; Cystatin-3; CST3
AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Molecular Weight

Approximately 15 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM PB, 200 mM Nacl, pH 6.5 or 10 mM PB, 200 mM NaCl, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin C/CST3 Protein, Human (HEK293)
Cat. No.:
HY-P72688
Quantity:
MCE Japan Authorized Agent: