CYTL1 Protein, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

CYTL1 protein exhibits specific expression in CD34+ hematopoietic cells, indicating its selective presence within this subset of cells involved in the regulation of hematopoiesis. This targeted expression pattern suggests a potential role for CYTL1 in the maintenance or differentiation of CD34+ hematopoietic cells, emphasizing its significance within the intricate network of molecular processes governing blood cell development and homeostasis. The specific association of CYTL1 with CD34+ cells implies a potential involvement in hematopoietic stem or progenitor cell functions, further underscoring its relevance in the finely tuned mechanisms of hematopoiesis.

Human

HEK293

C-mFc

Q9NRR1 (T23-R136)

54360  [NCBI]

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Approximately 43 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.