1. Recombinant Proteins
  2. Others
  3. CYTL1 Protein, Mouse (HEK293, Fc)

CYTL1 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. CYTL1 exhibits specific expression in CD34+ hematopoietic cells, indicating its selective presence within this subset of cells involved in the regulation of hematopoiesis. CYTL1 regulates chondrogenesis and is required for the maintenance of cartilage homeostasis and, in addition, may act as a regulator of embryo implantation in early pregnancy. CYTL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CYTL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CYTL1 Protein, Mouse (HEK293, Fc) is 114 a.a., with molecular weight of 48-52 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CYTL1 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. CYTL1 exhibits specific expression in CD34+ hematopoietic cells, indicating its selective presence within this subset of cells involved in the regulation of hematopoiesis. CYTL1 regulates chondrogenesis and is required for the maintenance of cartilage homeostasis and, in addition, may act as a regulator of embryo implantation in early pregnancy. CYTL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CYTL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CYTL1 Protein, Mouse (HEK293, Fc) is 114 a.a., with molecular weight of 48-52 kDa.

Background

CYTL1 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. CYTL1 exhibits specific expression in CD34+ hematopoietic cells, indicating its selective presence within this subset of cells involved in the regulation of hematopoiesis. This targeted expression pattern suggests a potential role for CYTL1 in the maintenance or differentiation of CD34+ hematopoietic cells, emphasizing its significance within the intricate network of molecular processes governing blood cell development and homeostasis. The specific association of CYTL1 with CD34+ cells implies a potential involvement in hematopoietic stem or progenitor cell functions, further underscoring its relevance in the finely tuned mechanisms of hematopoiesis. CYTL1 regulates chondrogenesis and is required for the maintenance of cartilage homeostasis and, in addition, may act as a regulator of embryo implantation in early pregnancy[1][2].

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

A1E5L0 (A26-S139)

Gene ID
Molecular Construction
N-term
CYTL1 (A26-S139)
Accession # A1E5L0
hFc
C-term
Synonyms
Protein C17; CYTL1; C4orf4
AA Sequence

APPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS

Molecular Weight

48-52 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CYTL1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CYTL1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77584
Quantity:
MCE Japan Authorized Agent: