CYTL1 Protein, Mouse (HEK293, Fc)

CYTL1 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. CYTL1 exhibits specific expression in CD34+ hematopoietic cells, indicating its selective presence within this subset of cells involved in the regulation of hematopoiesis. CYTL1 regulates chondrogenesis and is required for the maintenance of cartilage homeostasis and, in addition, may act as a regulator of embryo implantation in early pregnancy. CYTL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CYTL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CYTL1 Protein, Mouse (HEK293, Fc) is 114 a.a., with molecular weight of 48-52 kDa.

CYTL1 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. CYTL1 exhibits specific expression in CD34+ hematopoietic cells, indicating its selective presence within this subset of cells involved in the regulation of hematopoiesis. This targeted expression pattern suggests a potential role for CYTL1 in the maintenance or differentiation of CD34+ hematopoietic cells, emphasizing its significance within the intricate network of molecular processes governing blood cell development and homeostasis. The specific association of CYTL1 with CD34+ cells implies a potential involvement in hematopoietic stem or progenitor cell functions, further underscoring its relevance in the finely tuned mechanisms of hematopoiesis. CYTL1 regulates chondrogenesis and is required for the maintenance of cartilage homeostasis and, in addition, may act as a regulator of embryo implantation in early pregnancy^[1][2].

Mouse

HEK293

C-hFc

A1E5L0 (A26-S139)

231162  [NCBI]

APPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS

48-52 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.