1. Recombinant Proteins
  2. Others
  3. Cytochrome c/CYCS Protein, Human (His)

Cytochrome c/CYCS Protein, Human (His)

Cat. No.: HY-P70053
SDS COA Handling Instructions

Cytochrome c is an electron carrier protein that accepts electrons from cytochrome c1 and transfers them to the cytochrome oxidase complex in the mitochondrial electron transport chain. It is involved in apoptosis, where the release of cytochrome c into the cytosol leads to caspase-9 activation and subsequent acceleration of apoptosis. Cytochrome c/CYCS Protein, Human (His) is the recombinant human-derived Cytochrome c/CYCS protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cytochrome c/CYCS Protein, Human (His) is 104 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cytochrome c is an electron carrier protein that accepts electrons from cytochrome c1 and transfers them to the cytochrome oxidase complex in the mitochondrial electron transport chain. It is involved in apoptosis, where the release of cytochrome c into the cytosol leads to caspase-9 activation and subsequent acceleration of apoptosis. Cytochrome c/CYCS Protein, Human (His) is the recombinant human-derived Cytochrome c/CYCS protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cytochrome c/CYCS Protein, Human (His) is 104 a.a., with molecular weight of ~16.0 kDa.

Background

Cytochrome c/CYCS Protein functions as an essential electron carrier in cellular processes, particularly within the mitochondrial electron-transport chain. In its oxidized form, the cytochrome c heme group adeptly accepts an electron from the cytochrome c1 subunit of cytochrome reductase. Subsequently, this electron is transferred to the cytochrome oxidase complex, serving as the ultimate protein carrier in the mitochondrial electron-transport chain. Beyond its role in electron transport, cytochrome c plays a crucial part in apoptosis, wherein alterations in mitochondrial membrane permeability, induced by the suppression of anti-apoptotic members or activation of pro-apoptotic members of the Bcl-2 family, lead to the release of cytochrome c into the cytosol. The binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, initiating a cascade that accelerates apoptosis by activating other caspases. This dual functionality underscores the versatile and pivotal role of Cytochrome c/CYCS Protein in both energy metabolism and the regulation of programmed cell death.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P99999 (G2-E105)

Gene ID
Molecular Construction
N-term
CYCS (G2-E105)
Accession # P99999
6*His
C-term
Synonyms
rHuCytochrome c/CYCS, His; Cytochrome C; CYCS; CYC
AA Sequence

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 200 mM NaCl, 50% Glycerol, 0.05% Tween 80, pH7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cytochrome c/CYCS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cytochrome c/CYCS Protein, Human (His)
Cat. No.:
HY-P70053
Quantity:
MCE Japan Authorized Agent: