Decorin/PGS2 Protein, Mouse (HEK293, His)

Decorin/PGS2 protein, influencing fibril formation rate, binds strongly to type I and type II collagen, fibronectin, and TGF-beta. It participates in extracellular matrix organization by forming a ternary complex with MFAP2 and ELN, and interacts with DPT, potentially modulating matrix assembly and structure. Decorin/PGS2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Decorin/PGS2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Decorin/PGS2 Protein, Mouse (HEK293, His) is 338 a.a., with molecular weight of 41-50 kDa.

Decorin/PGS2 protein influences the rate of fibril formation and exhibits binding affinity towards type I and type II collagen, fibronectin, and TGF-beta. It also forms a ternary complex with MFAP2 and ELN, suggesting its involvement in extracellular matrix organization. Additionally, it interacts with DPT, further highlighting its potential role in modulating matrix assembly and structure.

Mouse

HEK293

C-6*His

P28654 (G17-K354)

13179  [NCBI]

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

41-50 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.